PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10013882m
Common NameCARUB_v10013882mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 399aa    MW: 42904.6 Da    PI: 4.905
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10013882mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.31.5e-174994147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEd  l ++v  +G ++W++Iar ++ gR++k+c++rw + 
  Carubv10013882m 49 KGPWSPEEDVVLSKLVDTHGARNWSLIARSIP-GRSGKSCRLRWCNQ 94
                     79******************************.***********985 PP

2Myb_DNA-binding50.74.1e-16101145147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r+++T+ Ed+ ++ a++ +G++ W++Ia+ ++ gRt++ +k++w++ 
  Carubv10013882m 101 RNSFTEVEDQAIITAHAIHGNK-WAAIAKILP-GRTDNAIKNHWNST 145
                      789*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.3244499IPR017930Myb domain
SuperFamilySSF466897.11E-3046142IPR009057Homeodomain-like
SMARTSM007171.6E-144897IPR001005SANT/Myb domain
PfamPF002491.2E-164994IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-2450102IPR009057Homeodomain-like
CDDcd001676.38E-145193No hitNo description
PROSITE profilePS5129418.527100150IPR017930Myb domain
SMARTSM007172.3E-15100148IPR001005SANT/Myb domain
PfamPF002491.5E-14101145IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-21103149IPR009057Homeodomain-like
CDDcd001672.21E-12103146No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 399 aa     Download sequence    Send to blast
MEGEIARRSE TTGLREVEES TTEVGIGGGD GDDDGAAGTS GRGGKDRVKG PWSPEEDVVL  60
SKLVDTHGAR NWSLIARSIP GRSGKSCRLR WCNQLDPTVI RNSFTEVEDQ AIITAHAIHG  120
NKWAAIAKIL PGRTDNAIKN HWNSTLRRRF MDLEKAKNMG TAGLVVENPG FGVASSEETL  180
SSGGGGQVTT PVVSPEGKEA TSMEICEEQC VEKTNGEGIS KQDGNDPPTL FHQGISKQDV  240
NDPPTLFRPV AQISSFNAYN HMEGSPSPHI QDQNQFQSSK QDAAMLRVLE GVYSELCVPQ  300
TCGGGCCTNN PVGIIQQDSL LGPEFVDYLD PPTFPSYELA AITTDISSLA WLRSGLESSS  360
VRAMEEAAVR LRPQGSRGHR DHYLVSEQGK NITNVLST*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-38431491107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00337DAPTransfer from AT3G09230Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankATAC0114361e-166AC011436.7 Arabidopsis thaliana chromosome III BAC F3L24 genomic sequence, complete sequence.
GenBankATHMYB1e-166D10936.1 Arabidopsis thaliana atmyb1 gene for ATMYB1 protein, complete cds.
GenBankCP0026861e-166CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006297844.10.0hypothetical protein CARUB_v10013882mg
TrEMBLR0G5C00.0R0G5C0_9BRAS; Uncharacterized protein
STRINGscaffold_301043.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM84922636
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09230.10.0myb domain protein 1